PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_08746
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MYB_related
Protein Properties Length: 1548aa    MW: 169528 Da    PI: 6.4704
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_08746genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.51.5e-08918958446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      WT  E + l++a + +G++ + ++a+ +g +R++ qck ++ k
       PEQU_08746 918 WTDKEKLMLIQALNIYGKD-FVKVAQFVG-TRSRDQCKIFYSK 958
                      *****************99.*********.********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.54E-12691753IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-5699752IPR009057Homeodomain-like
PROSITE profilePS5129314.582703754IPR017884SANT domain
SMARTSM007171.1E-7704752IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-6912958IPR009057Homeodomain-like
PROSITE profilePS5129314.843913964IPR017884SANT domain
SMARTSM007171.7E-8914962IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-10917961IPR009057Homeodomain-like
CDDcd001674.74E-7918956No hitNo description
PfamPF002498.3E-8918957IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1548 aa     Download sequence    Send to blast
MPSPHTWDRK EPFVKDRKQE RGAGCDAVGG GGGGGVGGGS CSTSRWREPY HGQREFPRAS  60
PRRPSSGHYR HDGGYQQLYS EESSGHGCTP SRSGDRFWQE EDIFRLSSGR CGGKESRGSS  120
RRSPSLDSGG DSARPHLAPP LAAQRSVAVP ITNASSSSLS PIPWKNVLDK SDGVETGQKY  180
DRDHSLGPIA WKPLKWSRPS SVQTPKTGRC EAEDANLEIS APHVKDSPAR SPFTSLLQSD  240
DRAPNKKPRL GWGQGLAKYE KQKIEGSVDV SAHNGSAQST SSAKIVVGDS SPKFSVLPGS  300
MSPATPTSVA CSSSPAATDE KLPIKGLNSE TDRAQCSDSS GLGIHNSPKD ISIKFDQLDA  360
NSISSLALLL SDLLQPEDAC SGDSSFTRNS TINKLLLLKK NISKELEKTE CEIDLFENRL  420
KSIDGDGQIN SFQECSESLA ELSSSDNCIA ASSVSLEGQM AVPRNFSEEQ ATTVKGTFHP  480
SSDGIICVSS QFPSLETENP NSSLDYRTEK EDNSLLDFIM TSNRDAAKKA LEEFDGAIPP  540
WLAQYNFSEL DFSQCKKNYI SIRERLVIKK RVLKFKEHIL ALKYKALHHL WREDLKVLTM  600
RKHQPKSSKR YEVNSRSSHN AIQKHRSSIR SRFALPAENL TLVPSTDVIN FTSKLLLDSQ  660
VRLYRDNLKM PAQIIDENDR RYSKFNSNNG LIEDPVALEK ERVTVNPWMQ EEKEIFLEKL  720
ARCGKDFEKI SSFLTHKTTA DCIEFYYKNH KSESFTEVKK HLKWRKQLQN RQSNTYLITS  780
GARFNRETNT TSLELLGAAS LMASEGNCNR RSSSLKQSGK SGCYDARVSR RSNGSLEKTN  840
SEISGSEREA AAADVLAGIC GALSSDAMSS CITSSVDLPE KFRFASIDCS LTPEGAHTID  900
EEDMCSDDSS DELESADWTD KEKLMLIQAL NIYGKDFVKV AQFVGTRSRD QCKIFYSKAR  960
KCLCLDVIQP GSANEVTPLS DVNGGRSDSD DACAAEIDSA ICSTQSCSKI DADFTQSILE  1020
TCSEGHTQQA DADGPCEQCE IVGSIPGEAE ANLNNKASVL NENKLLIVGG NLEFVKDHGE  1080
ICSFSSRSNE PESSNKSTNE MLLTEKSKSQ TVASASASDE LSKEQNLNQL VEVFDSVGEK  1140
TASVKIEEIV NVGESLMFCP ISYSKGSSCD DGENKNVEYP PSLLSSNFPL HAPLEVPSSL  1200
QNRPQIKIVQ PDSAVSISFN GKDSSISLFN LQDGEKSLQE SVCRDLSPIP LHHPFSNQID  1260
PLLAARGCSM QSLIENHKEL KINRKMIVES SVMANTFSQS NSSSVPGSHN DKCVGEGFLN  1320
SRSEISMVPR PDHKSEQNLT AGSGDQSHRG GDLKLFGQIL THQFSQKSHE SGKVSLSPRQ  1380
NSNATNNSSS TRWKDAAIFA PRPGRNGLVH HLGELPQRSY GFWDGNQIQT GLPSLPEPTI  1440
MLANYPPFSI SKEIIATGNK DDYKQAQNCS LSTEKFLETY PESQKRNGFD SLSGFPHEGR  1500
MMHHLGGVVV GGSGVSDPVA AIQMHYSGRR TKIFSGDLES LTGDTRGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-14670755993NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-14670755993NUCLEAR RECEPTOR COREPRESSOR 2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-99MYB family protein